PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009597408.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 253aa    MW: 29695.4 Da    PI: 8.2943
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009597408.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-14855148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+++Ed++l+ +v+++G ++W+  a+  g++Rt+k+c++rw +yl
   XP_009597408.1  8 KGPWSEQEDLQLAFYVNLFGDRRWDFLAKVSGLKRTGKSCRLRWVNYL 55
                     79********************************************97 PP

2Myb_DNA-binding49.68.9e-1661106148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l+++++ ++G++ W++Ia +++ gRt++++k++w++++
   XP_009597408.1  61 RGKMTPQEERLILELHSKWGNR-WSRIAWKLP-GRTDNEIKNYWRTHM 106
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.869355IPR017930Myb domain
SuperFamilySSF466891.58E-277102IPR009057Homeodomain-like
SMARTSM007176.8E-12757IPR001005SANT/Myb domain
PfamPF002491.3E-13855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-20962IPR009057Homeodomain-like
CDDcd001671.27E-71055No hitNo description
PROSITE profilePS5129426.10256110IPR017930Myb domain
SMARTSM007179.9E-1560108IPR001005SANT/Myb domain
PfamPF002491.2E-1461105IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-2363109IPR009057Homeodomain-like
CDDcd001671.06E-963106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MAQEEARKGP WSEQEDLQLA FYVNLFGDRR WDFLAKVSGL KRTGKSCRLR WVNYLHPGLK  60
RGKMTPQEER LILELHSKWG NRWSRIAWKL PGRTDNEIKN YWRTHMRKKA QDDRKNKASI  120
SPSSSFSNCS SYFSSNSPDV DFMPITENNE RNFYDTGGLL GVHEQSSLQN AGKKKVGDQE  180
KGKSMKVYSM DEIWKDIELL SEENEKKNKP ILPISTMWEY CPDSTLWMTD EEETKMFPQF  240
YCLDNQDNSF FTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-2651101105MYB PROTO-ONCOGENE PROTEIN
1h8a_C5e-26511024128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597408.10.0PREDICTED: transcription factor MYB48-like
RefseqXP_016482956.10.0PREDICTED: transcription factor MYB48-like
SwissprotQ53NK64e-72MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLK4C3171e-116K4C317_SOLLC; Uncharacterized protein
STRINGSolyc06g005330.2.11e-116(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.13e-70myb domain protein 48